£50.00
In stock
NovaVitality is proud to offer IGF-1 LR3 (Long Arginine 3-IGF-1), a high-purity research peptide designed for advanced biochemical investigation. Supplied in 1mg quantities, this compound is engineered for laboratory environments where data integrity and compound stability are critical. Ideal for in vitro studies, NovaVitality ensures this product meets the demanding requirements of modern scientific exploration.
Notice: Bacteriostatic Water - 3mL, Insulin Syringe 1mL will be added to your cart.
NovaVitality IGF-1 LR3 1mg | Premium Research Grade Peptide
Product Specifications
- Product Name: IGF-1 LR3 (Long Arginine 3-IGF-1)
- Brand: NovaVitality
- SKU: NV-IGF1LR3-1MG
- Molecular Weight: 9117.60 g/mol
- Purity: ≥98% (HPLC Verified)
- Physical Form: Lyophilised Solid
- Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Handling and Storage To maintain structural integrity, NovaVitality supplies IGF-1 LR3 in a stable lyophilised solid form. For optimal results within a research setting, please adhere to standard laboratory protocols for reconstitution. Detailed storage instructions and handling guidelines are available via the NovaVitality resource centre to ensure the longevity of your research materials.
Quality Assurance & Synthesis Every batch of NovaVitality IGF-1 LR3 is produced under strictly controlled conditions to guarantee consistency. Our commitment to quality means each vial undergoes rigorous testing to confirm purity levels of ≥98%. We understand that reliable data depends on reliable materials, which is why our quality control processes are designed to meet the high standards expected by the scientific community.
Legal and Safety Disclaimer Important: NovaVitality distributes IGF-1 LR3 strictly for laboratory and scientific research purposes only. This product is not intended for human consumption, clinical use, or therapeutic application. It is not a dietary supplement or medication. By purchasing this item, the buyer acknowledges and agrees to use this compound solely in accordance with applicable laws and regulations governing research chemicals.
| Weight | 5 g |
|---|---|
| Dimensions | 1.55 × 3.85 mm |
Related products
Price range: £65.00 through £220.00
Select options
This product has multiple variants. The options may be chosen on the product page
Price range: £55.00 through £200.00
Select options
This product has multiple variants. The options may be chosen on the product page
Price range: £4.00 through £7.00
Select options
This product has multiple variants. The options may be chosen on the product page
